PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0534s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 336aa    MW: 37124.5 Da    PI: 5.4038
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0534s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.7e-142067148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
  SapurV1A.0534s0230.1.p 20 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 67
                            678*******************************************97 PP

2Myb_DNA-binding50.54.9e-1673116146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             rg+++++E+e +++++ +lG++ W+ Ia++++ gRt++++k++w++
  SapurV1A.0534s0230.1.p  73 RGAFSPQEEEMIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                             89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.251567IPR017930Myb domain
SuperFamilySSF466891.13E-2718114IPR009057Homeodomain-like
SMARTSM007171.3E-91969IPR001005SANT/Myb domain
PfamPF002493.1E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-222174IPR009057Homeodomain-like
CDDcd001672.23E-82367No hitNo description
PROSITE profilePS5129425.3868122IPR017930Myb domain
SMARTSM007171.0E-1572120IPR001005SANT/Myb domain
PfamPF002498.0E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2675123IPR009057Homeodomain-like
CDDcd001671.92E-1175115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MRKPEASGKN NVSSSNKFRK GLWSPEEDDK LMNYMLNNGQ GCWSDVARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EEMIIHLHSL LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKNLKSSNA SPNTSDSSSE PGKDVMGGLM AMQEQGIFSM NTDPSLSSSS SLATSMKAML  180
LNSMMDPLLP ILDYDHHGLN SMYGTGASGY DPISAPPCVA QVGVLGGGDH GFYGEGIFEG  240
INVEIPPLES VSCMEENART QNTQDDNTDK YSYCSPVNSL YHKTCNIASN NNKTDNIAAD  300
HTGSFWQGEE LKVGEWDLEE LMKDVSAFPF LDFHQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27201227108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486780.0KF148678.1 Populus trichocarpa MYB transcription factor (MYB21) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025528.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV21e-74MYB46_ARATH; Transcription factor MYB46
TrEMBLS5XGT40.0S5XGT4_POPTR; MYB transcription factor
STRINGPOPTR_0009s05860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.13e-73myb domain protein 46